PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10008268
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 440aa    MW: 48428.9 Da    PI: 7.0601
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10008268genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.32.7e-23143186144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+ep+rC+RtDGKkWRCsr+v +++k+CErH  ++r rsrk++e
  Lus10008268 143 DPEPWRCKRTDGKKWRCSRDVAPDHKYCERHTRKSRPRSRKPVE 186
                  79***************************************986 PP

2QLQ48.91.9e-1790121132
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLl 32 
                  s+FTaaQ+q+L++Q  ++KyL+a++P+Pp+L+
  Lus10008268  90 SPFTAAQWQELERQTIILKYLMASLPLPPHLI 121
                  89****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-790126IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.77991126IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.5E-1291121IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.964143187IPR014977WRC domain
PfamPF088791.4E-18144186IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MVSASSDDDC GLALKLQKLP SCNDNMALLI PHHHHDHGGE SGPLCFSRST NSVSSSVPEF  60
THIYNGALLP PPAADVFPPV SRSNHSSGES PFTAAQWQEL ERQTIILKYL MASLPLPPHL  120
IPKPPSNMGR HSLELGISTR QSDPEPWRCK RTDGKKWRCS RDVAPDHKYC ERHTRKSRPR  180
SRKPVEFHFD DNTTMNHKPN LQGLTPSSYF PFFSPPATAA ASDSIPYEPP SNLEWFLKGE  240
ANAVPSDYYY MRKDDKDSIF GLDHHREKQP TFPSTPLHCE WLGNDDHYNT WFYTLPKSTT  300
SSMDAATATA LTPGGLAQGQ ETRHFLDAWS TTNHREKNYI TRLDRKKSSP VSSADKATLP  360
LTLSMCGGDG GGGGSTETSY EEVEGTSLRT QWLPHGSWPM SSPPGGPLAE ALCLGISSSS  420
SKSPPNLTSG INSSFPDKW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518921.14e-79PREDICTED: growth-regulating factor 8 isoform X1
TrEMBLB9RYV24e-79B9RYV2_RICCO; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF138941621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-26growth-regulating factor 2